PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009793957.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family FAR1
Protein Properties Length: 379aa    MW: 44219.4 Da    PI: 7.5491
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009793957.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR125.34.9e-0826625591
            FAR1 55 raetrtgCkaklkvkkekdgkwevtkleleHnHelap 91
                     +++  +Cka+l   ++++g w+v+k++++HnH+l p
  XP_009793957.1 26 FTTKTNNCKARLATVLDDSGCWRVSKVVHDHNHDLLP 62
                    3456668***************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031017.9E-62562IPR004330FAR1 DNA binding domain
PfamPF105513.9E-21154224IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MENEFTDEDV VVGPISGMTR IRRIKFTTKT NNCKARLATV LDDSGCWRVS KVVHDHNHDL  60
LPSVSHLMAG HGSVCDSLKR DLVAHDRSSI RPSKNIRLDE VQRGGPQNLG CTPKDCRNYI  120
LKSRNFEMQE GDAQSLLNFF REIQAAYEQF HDAICFDTTY LVNQYNMPCA SFVGINHHRQ  180
SILLGCALMS HEDIDSYKLV FRTWLDAMGN VHPDAIITDQ CQSISGVRPS KIARAEFKSM  240
VLDSITVEVF ERKWAEYISR YNLHIRNWFN KLYSEKEKWV PVYLDMYFWG GMLFTQRSEG  300
MHAFFDGYIT RQSTFRMFVH QYELAIRAKH EKELEAEYRS KGFQIVCESM FKWEQQTIQC  360
YTRTIYEIFQ DTAKKIVSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009793957.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1301943
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-56FAR1-related sequence 5